PDB entry 1vel

View 1vel on RCSB PDB site
Description: Mycobacterium smegmatis Dps tetragonal form
Class: DNA binding protein
Keywords: DNA-binding protein, DNA BINDING PROTEIN
Deposited on 2004-04-01, released 2004-06-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.183
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1vela_
  • Chain 'B':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1velb_
  • Chain 'C':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1velc_
  • Chain 'D':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1veld_
  • Chain 'E':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1vele_
  • Chain 'F':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1velf_
  • Heterogens: CD, NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1velA (A:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1velA (A:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesaggqlth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1velB (B:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1velB (B:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesaggqlth
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1velC (C:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1velC (C:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesaggqlthegq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1velD (D:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1velD (D:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesaggqlth
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1velE (E:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1velE (E:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlth
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1velF (F:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1velF (F:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesaggqlth