PDB entry 1ve5

View 1ve5 on RCSB PDB site
Description: Crystal Structure of T.th. HB8 Threonine deaminase
Class: lyase
Keywords: threonine deaminase catabolic, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-03-27, released 2005-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.202
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Threonine deaminase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ve5a1
  • Chain 'B':
    Compound: Threonine deaminase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ve5b1
  • Chain 'C':
    Compound: Threonine deaminase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ve5c1
  • Chain 'D':
    Compound: Threonine deaminase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ve5d1
  • Heterogens: CA, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ve5A (A:)
    mpslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskal
    alenpkgllavssgnhaqgvayaaqvlgvkalvvmpedaspykkacaraygaevvdrgvt
    aknreevaralqeetgyalihpfddplviagqgtaglellaqagrmgvfpgavlapvggg
    gllaglatavkalspttlvlgvepeaaddakrsleagrilrleapprtradgvrtlslge
    rtfpilrervdgiltvseealleaerllftrtkqvveptgalplaavlehgarlpqtlal
    llsggnrdfsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ve5A (A:)
    pslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskala
    lenpkgllavssgnhaqgvayaaqvlgvkalvvmpedpykkacaraygaevvdrgvtakn
    reevaralqeetgyalihpfddplviagqgtaglellaqagrmgvfpgavlapvggggll
    aglatavkalspttlvlgvepeaaddakrsleagrilrleapprtradgvrtlslgertf
    pilrervdgiltvseealleaerllftrtkqvveptgalplaavlehgarlpqtlallls
    ggnrdfsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ve5B (B:)
    mpslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskal
    alenpkgllavssgnhaqgvayaaqvlgvkalvvmpedaspykkacaraygaevvdrgvt
    aknreevaralqeetgyalihpfddplviagqgtaglellaqagrmgvfpgavlapvggg
    gllaglatavkalspttlvlgvepeaaddakrsleagrilrleapprtradgvrtlslge
    rtfpilrervdgiltvseealleaerllftrtkqvveptgalplaavlehgarlpqtlal
    llsggnrdfsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ve5B (B:)
    pslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskala
    lenpkgllavssgnhaqgvayaaqvlgvkalvvmpkkacaraygaevvnreevaralqee
    tgyalihpfddplviagqgtaglellaqagrmgvfpgavlapvggggllaglatavkals
    pttlvlgvepeaaddakrsleagrilrleapprtradgvrtlslgertfpilrervdgil
    tvseealleaerllftrtkqvveptgalplaavlehgarlpqtlalllsggnrdfsp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ve5C (C:)
    mpslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskal
    alenpkgllavssgnhaqgvayaaqvlgvkalvvmpedaspykkacaraygaevvdrgvt
    aknreevaralqeetgyalihpfddplviagqgtaglellaqagrmgvfpgavlapvggg
    gllaglatavkalspttlvlgvepeaaddakrsleagrilrleapprtradgvrtlslge
    rtfpilrervdgiltvseealleaerllftrtkqvveptgalplaavlehgarlpqtlal
    llsggnrdfsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ve5C (C:)
    pslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskala
    lenpkgllavssgnhaqgvayaaqvlgvkalvalqeetgyalihpfddplviagqgtagl
    ellaqagrmgvfpgavlapvggggllaglatavkalspttlvlgvepeaaddakrsleag
    rilrleapprtradgvrtlslgertfpilrervdgiltvseealleaerllftrtkqvve
    ptgalplaavlehgarlpqtlalllsggnrdfsp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ve5D (D:)
    mpslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskal
    alenpkgllavssgnhaqgvayaaqvlgvkalvvmpedaspykkacaraygaevvdrgvt
    aknreevaralqeetgyalihpfddplviagqgtaglellaqagrmgvfpgavlapvggg
    gllaglatavkalspttlvlgvepeaaddakrsleagrilrleapprtradgvrtlslge
    rtfpilrervdgiltvseealleaerllftrtkqvveptgalplaavlehgarlpqtlal
    llsggnrdfsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ve5D (D:)
    pslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskala
    lenpkgllavssgnhaqgvayaaqvlgvkalvvmpvaralqeetgyalihpfddplviag
    qgtaglellaqagrmgvfpgavlapvggggllaglatavkalspttlvlgvepeaaddak
    rsleagrilrleapprtradgvrtlslgertfpilrervdgiltvseealleaerllftr
    tkqvveptgalplaavlehgarlpqtlalllsggnrdfsp