PDB entry 1ve1

View 1ve1 on RCSB PDB site
Description: Crystal Structure of T.th. HB8 O-acetylserine sulfhydrylase
Class: transferase
Keywords: PLP, transferase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-03-26, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.22
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-acetylserine sulfhydrylase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ve1a1
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ve1A (A:)
    mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
    sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
    laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
    tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
    weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
    yaep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ve1A (A:)
    mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
    sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
    laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
    tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
    weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
    ya