PDB entry 1vd2

View 1vd2 on RCSB PDB site
Description: solution structure of the pb1 domain of pkciota
Deposited on 2004-03-18, released 2004-09-14
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1vd2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vd2A (A:)
  gplgsqvrvkayyrgdimithfepsisfeglcnevrdmcsfdneqlftmkwideegdpct
  vssqleleeafrlyelnkdsellihvfpc