PDB entry 1vcx

View 1vcx on RCSB PDB site
Description: Neutron Crystal Structure of the Wild Type Rubredoxin from Pyrococcus Furiosus at 1.5A Resolution
Class: electron transport
Keywords: Neutron structure, Hydrogen atom position, Hydration water structure, Hydrogen/Deuterium exchange, Iron-sulfur core, N-terminal region, ELECTRON TRANSPORT
Deposited on 2004-03-17, released 2004-08-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NEUT
Resolution: 1.5 Å
R-factor: 0.186
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rubredoxin
  Species: Pyrococcus furiosus [TaxId:2261]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24297 (0-52)
  Domains in SCOPe 2.04: d1vcxa_
• Heterogens: FE, DOD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vcxA (A:)
  akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled