PDB entry 1vcu

View 1vcu on RCSB PDB site
Description: Structure of the human cytosolic sialidase Neu2 in complex with the inhibitor DANA
Class: hydrolase
Keywords: sialidase, neuraminidase, ganglioside, dana, sialic acid, hydrolase
Deposited on 2004-03-12, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.195
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialidase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vcua_
  • Chain 'B':
    Compound: Sialidase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vcub_
  • Heterogens: DAN, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vcuA (A:)
    gsmaslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgd
    ydapthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtr
    anvtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpa
    yayrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnars
    hlrarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythp
    thswqradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeand
    yeeivflmftlkqafpaeylpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcuA (A:)
    maslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdyd
    apthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtran
    vtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpaya
    yrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaeveqrvvtlnarshlrar
    vqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprspaqwllythpthswqradl
    gaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmf
    tlkqafpaey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vcuB (B:)
    gsmaslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgd
    ydapthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtr
    anvtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpa
    yayrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnars
    hlrarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythp
    thswqradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeand
    yeeivflmftlkqafpaeylpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcuB (B:)
    maslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdyd
    apthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtran
    vtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpaya
    yrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshl
    rarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprspaqwllythpthswqr
    adlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeeivf
    lmftlkqafpaey