PDB entry 1vcq

View 1vcq on RCSB PDB site
Description: semliki forest virus capsid protein (crystal form ii)
Deposited on 1996-03-04, released 1996-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.157
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1vcqa_
  • Chain 'B':
    Domains in SCOP 1.55: d1vcqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vcqA (A:)
    cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
    sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
    negsrtalsvvtwnkdmvtrvtpegseew
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vcqB (B:)
    cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
    sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
    negsrtalsvvtwnkdmvtrvtpegseew