PDB entry 1vcp

View 1vcp on RCSB PDB site
Description: semliki forest virus capsid protein (crystal form i)
Deposited on 1996-03-04, released 1996-12-07
The last revision prior to the SCOP 1.63 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.157
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1vcpa_
  • Chain 'B':
    Domains in SCOP 1.63: d1vcpb_
  • Chain 'C':
    Domains in SCOP 1.63: d1vcpc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vcpA (A:)
    cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
    sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
    negsrtalsvvtwnkdmvtrvtpegseew
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vcpB (B:)
    cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
    sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
    negsrtalsvvtwnkdmvtrvtpegseew
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vcpC (C:)
    cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
    sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
    negsrtalsvvtwnkdmvtrvtpegseew