PDB entry 1vbz

View 1vbz on RCSB PDB site
Description: Crystal Structure of the Hepatitis Delta Virus Gemonic Ribozyme Precursor, with C75U mutaion, in Ba2+ solution
Deposited on 2004-03-03, released 2004-05-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-18, with a file datestamp of 2004-05-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.253
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vbza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vbzA (A:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbzA (A:)
    petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
    satnalrsmqgfpfydkpmriqyaktdsdiiakmk