PDB entry 1vbx
View 1vbx on RCSB PDB site
Description: Crystal Structure of the Hepatitis Delta Virus Gemonic Ribozyme Precursor, with C75U mutaion, in EDTA solution
Class: translation/RNA
Keywords: HDV, ribozyme, RNA, U1A, precursor, TRANSLATION/RNA COMPLEX
Deposited on
2004-03-03, released
2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.252
AEROSPACI score: 0.26
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: U1 small nuclear ribonucleoprotein A
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P09012
- engineered (30)
- engineered (35)
Domains in SCOPe 2.08: d1vbxa_ - Chain 'B':
Compound: Hepatitis Delta virus ribozyme
Species: synthetic, synthetic
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1vbxA (A:)
mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
evssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgt
Sequence, based on observed residues (ATOM records): (download)
>1vbxA (A:)
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk
- Chain 'B':
No sequence available.