PDB entry 1vbt

View 1vbt on RCSB PDB site
Description: Structure of cyclophilin complexed with sulfur-substituted tetrapeptide AAPF
Class: isomerase/isomerase substrate
Keywords: cyclophilin a, peptidyl-prolyl isomerase, competitive inhibitor, isomerase-isomerase substrate complex
Deposited on 1998-06-16, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbta_
  • Chain 'B':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbtb_
  • Chain 'C':
    Compound: sulfur-substituted tetrapeptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1VBT (0-4)
  • Chain 'D':
    Compound: sulfur-substituted tetrapeptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1VBT (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vbtA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbtA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vbtB (B:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbtB (B:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.