PDB entry 1vbs

View 1vbs on RCSB PDB site
Description: structure of cyclophilin complexed with (d)ala containing tetrapeptide
Class: isomerase/ isomerase substrate
Keywords: cyclophilin a, peptidyl-prolyl isomerase, competitive inhibitor, complex (isomerase-peptide), isomerase- isomerase substrate complex
Deposited on 1998-06-16, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbsa_
  • Chain 'B':
    Compound: Tetrapeptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1VBS (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vbsA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbsA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    No sequence available.