PDB entry 1vbr

View 1vbr on RCSB PDB site
Description: Crystal structure of complex xylanase 10B from Thermotoga maritima with xylobiose
Class: hydrolase
Keywords: xylanase 10B, hydrolase
Deposited on 2004-03-02, released 2005-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase B
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vbra1
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase B
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vbrb_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vbrA (A:)
    sqnvslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihper
    drynftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvs
    hfkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysie
    einaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyite
    mdvriplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygka
    llfdenynpkpcyyaikevlekkieerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbrA (A:)
    vslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdry
    nftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfk
    grvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysieein
    aksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitemdv
    riplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygkallf
    denynpkpcyyaikevlekkieer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vbrB (B:)
    sqnvslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihper
    drynftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvs
    hfkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysie
    einaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyite
    mdvriplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygka
    llfdenynpkpcyyaikevlekkieerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbrB (B:)
    vslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdry
    nftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfk
    grvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysieein
    aksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitemdv
    riplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygkallf
    denynpkpcyyaikevlekkieer