PDB entry 1vb8

View 1vb8 on RCSB PDB site
Description: solution structure of vhr1, the first cyclotide from root tissue
Deposited on 2004-02-25, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vb8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vb8A (A:)
    caescvwipctvtallgcscsnkvcyngip