PDB entry 1vb3

View 1vb3 on RCSB PDB site
Description: Crystal Structure of Threonine Synthase from Escherichia coli
Class: lyase
Keywords: PLP-dependent enzyme, LYASE
Deposited on 2004-02-21, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonine synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vb3a1
  • Heterogens: SO4, KPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vb3A (A:)
    mklynlkdhneqvsfaqavtqglgknqglffphdlpefslteidemlkldfvtrsakils
    afigdeipqeileervraafafpapvanvesdvgclelfhgptlafkdfggrfmaqmlth
    iagdkpvtiltatsgdtgaavahafyglpnvkvvilyprgkisplqeklfctlggnietv
    aidgdfdacqalvkqafddeelkvalglnsansinisrllaqicyyfeavaqlpqetrnq
    lvvsvpsgnfgdltagllakslglpvkrfiaatnvndtvprflhdgqwspkatqatlsna
    mdvsqpnnwprveelfrrkiwqlkelgyaavddettqqtmrelkelgytsephaavayra
    lrdqlnpgeyglflgtahpakfkesveailgetldlpkelaeradlpllshnlpadfaal
    rklmmnhq