PDB entry 1v9i

View 1v9i on RCSB PDB site
Description: Crystal Structure Analysis of the site specific mutant (Q253C) of bovine carbonic anhydrase II
Class: lyase
Keywords: beta sheet, zinc metalloenzyme, lyase
Deposited on 2004-01-26, released 2004-02-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.247
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: carbonic anhydrase II
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00921 (2-260)
      • cloning artifact (0-1)
      • engineered (254)
    Domains in SCOPe 2.03: d1v9ic_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9iC (C:)
    rcshhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrm
    vnnghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelh
    lvhwntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfd
    pgsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepell
    mlanwrpaqplknrcvrgfpk