PDB entry 1v70

View 1v70 on RCSB PDB site
Description: Crystal Structure of probable antibiotics synthesis protein from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Structural genomics, Thermus thermophilus HB8, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2003-12-05, released 2004-12-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.203
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable antibiotics synthesis protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1v70a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v70A (A:)
    meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev
    vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp