PDB entry 1v6e

View 1v6e on RCSB PDB site
Description: solution structure of a n-terminal ubiquitin-like domain in mouse tubulin-specific chaperone b
Deposited on 2003-11-29, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1v6ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6eA (A:)
    gssgssgvmvfissslnsfrsekrysrsltiaefkcklelvvgspascmelelygaddkf
    yskldqedallgsypvddgcrihvidhsgsgpssg