PDB entry 1v6a

View 1v6a on RCSB PDB site
Description: Crystal Structure of L-lactate dehydrogenase from Cyprinus carpio
Class: oxidoreductase
Keywords: L-LACTATE DEHYDROGENASE, Cyprinus carpio, NADH, M-TYPE, OXIDOREDUCTASE
Deposited on 2003-11-28, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Cyprinus carpio [TaxId:7962]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v6aa1, d1v6aa2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Cyprinus carpio [TaxId:7962]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v6ab1, d1v6ab2
  • Heterogens: TRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6aA (A:)
    astkeklithvskeepagptnkvtvvgvgmvgmaaaisillkdltdelalvdvmedklkg
    eamdlqhgslflkthkivadkdysvtanskvvvvtagarqqegesrlnlvqrnvnifkfi
    ipniikyspncillvvsnpvdiltyvawklsglprnrvigsgtnldsarfrhlmgeklgi
    hpsnchgwvigehgdssvpvwsgvnvagvflqglnpdmgtdkdkedwksvhkmvvdsaye
    viklkgytswaigmsaadlcqsilknlrkchpvstlvkgmhgvneevflsvpcilgnsgl
    tdvvhmtlksdeekqlvksaetlwgvqkdltl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6aB (B:)
    astkeklithvskeepagptnkvtvvgvgmvgmaaaisillkdltdelalvdvmedklkg
    eamdlqhgslflkthkivadkdysvtanskvvvvtagarqqegesrlnlvqrnvnifkfi
    ipniikyspncillvvsnpvdiltyvawklsglprnrvigsgtnldsarfrhlmgeklgi
    hpsnchgwvigehgdssvpvwsgvnvagvflqglnpdmgtdkdkedwksvhkmvvdsaye
    viklkgytswaigmsaadlcqsilknlrkchpvstlvkgmhgvneevflsvpcilgnsgl
    tdvvhmtlksdeekqlvksaetlwgvqkdltl