PDB entry 1v47

View 1v47 on RCSB PDB site
Description: Crystal structure of ATP sulfurylase from Thermus thermophillus HB8 in complex with APS
Deposited on 2003-11-11, released 2004-04-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v47A (A:)
    mvetlpaleigederldlenlatgaffpvkgfmtreealsvahemrlptgevwtipillq
    frekprvgpgntvallhggervallhvaeayeldlealaravfgtdsethpgvarlygkg
    pyalagrvevlkprprtplektpeevraffrqrgwrkvvafqtrnaphraheylirlgle
    ladgvlvhpilgakkpddfpteviveayqalirdflpqervaffglatpmryagpkeavf
    halvrknfgathflvgrdhagvgdfydpyaahrifdrlpplgieivkvgavfhcplcggi
    asertcpeghrekrtaismtkvrallregkappselvrpellpilrrgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v47A (A:)
    tlpaleigederldlenlatgaffpvkgfmtreealsvahemrlptgevwtipillqfre
    kprvgpgntvallhggervallhvaeayeldlealaravfgtdsethpgvarlygkgpya
    lagrvevlkprprtplektpeevraffrqrgwrkvvafqtrnaphraheylirlglelad
    gvlvhpilgakkpddfpteviveayqalirdflpqervaffglatpmryagpkeavfhal
    vrknfgathflvgrdhagvgdfydpyaahrifdrlpplgieivkvgavfhcplcggiase
    rtcpeghrekrtaismtkvrallregkappselvrpellpilrrgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v47B (B:)
    mvetlpaleigederldlenlatgaffpvkgfmtreealsvahemrlptgevwtipillq
    frekprvgpgntvallhggervallhvaeayeldlealaravfgtdsethpgvarlygkg
    pyalagrvevlkprprtplektpeevraffrqrgwrkvvafqtrnaphraheylirlgle
    ladgvlvhpilgakkpddfpteviveayqalirdflpqervaffglatpmryagpkeavf
    halvrknfgathflvgrdhagvgdfydpyaahrifdrlpplgieivkvgavfhcplcggi
    asertcpeghrekrtaismtkvrallregkappselvrpellpilrrgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v47B (B:)
    tlpaleigederldlenlatgaffpvkgfmtreealsvahemrlptgevwtipillqfre
    kprvgpgntvallhggervallhvaeayeldlealaravfgtdsethpgvarlygkgpya
    lagrvevlkprprtplektpeevraffrqrgwrkvvafqtrnaphraheylirlglelad
    gvlvhpilgakkpddfpteviveayqalirdflpqervaffglatpmryagpkeavfhal
    vrknfgathflvgrdhagvgdfydpyaahrifdrlpplgieivkvgavfhcplcggiase
    rtcpeghrekrtaismtkvrallegkappselvrpellpilrr