PDB entry 1v40

View 1v40 on RCSB PDB site
Description: First Inhibitor Complex Structure of Human Hematopoietic Prostaglandin D Synthase
Class: isomerase
Keywords: hematopoietic prostaglandin d synthase, pgds, gst, sigma-2 class gst, ligase, isomerase
Deposited on 2003-11-07, released 2004-11-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760
      • conflict (142)
    Domains in SCOPe 2.06: d1v40a1, d1v40a2
  • Chain 'B':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760
      • conflict (142)
    Domains in SCOPe 2.06: d1v40b1, d1v40b2
  • Chain 'C':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760
      • conflict (142)
    Domains in SCOPe 2.06: d1v40c1, d1v40c2
  • Chain 'D':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760 (0-197)
      • conflict (142)
    Domains in SCOPe 2.06: d1v40d1, d1v40d2
  • Heterogens: MG, GSH, O16, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v40A (A:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v40B (B:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v40C (C:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v40D (D:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl