PDB entry 1v2a

View 1v2a on RCSB PDB site
Description: Glutathione S-transferase 1-6 from Anopheles dirus species B
Class: transferase
Keywords: Glutathione S-Transferase, detoxification, glutathione, xenobiotics, TRANSFERASE
Deposited on 2003-10-10, released 2003-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.234
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione transferase gst1-6
    Species: Anopheles dirus [TaxId:7168]
    Gene: AdGST1-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1v2aa1, d1v2aa2
  • Chain 'B':
    Compound: glutathione transferase gst1-6
    Species: Anopheles dirus [TaxId:7168]
    Gene: AdGST1-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1v2ab1, d1v2ab2
  • Chain 'C':
    Compound: glutathione transferase gst1-6
    Species: Anopheles dirus [TaxId:7168]
    Gene: AdGST1-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1v2ac1, d1v2ac2
  • Chain 'D':
    Compound: glutathione transferase gst1-6
    Species: Anopheles dirus [TaxId:7168]
    Gene: AdGST1-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1v2ad1, d1v2ad2
  • Heterogens: GTS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v2aA (A:)
    mdyyyslisppcqsaillakklgitlnlkktnvhdpverdaltklnpqhtiptlvdnghv
    vwesyaivlylvetyakddtlypkdpkvrsvvnqrlffdigtlykriidvihlvmkkeqp
    sdeqmeklkgaldlleqfvterayaaadhltvadicllgtvtalnwlkhdlepfphiraw
    lervraempdyeefskqvaddtlayvasrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2aA (A:)
    mdyyyslisppcqsaillakklgitlnlkktnvhdpverdaltklnpqhtiptlvdnghv
    vwesyaivlylvetyakddtlypkdpkvrsvvnqrlffdigtlykriidvihlvmkkeqp
    sdeqmeklkgaldlleqfvterayaaadhltvadicllgtvtalnwlkhdlepfphiraw
    lervraempdyeefskqvaddtlayvas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v2aB (B:)
    mdyyyslisppcqsaillakklgitlnlkktnvhdpverdaltklnpqhtiptlvdnghv
    vwesyaivlylvetyakddtlypkdpkvrsvvnqrlffdigtlykriidvihlvmkkeqp
    sdeqmeklkgaldlleqfvterayaaadhltvadicllgtvtalnwlkhdlepfphiraw
    lervraempdyeefskqvaddtlayvasrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2aB (B:)
    mdyyyslisppcqsaillakklgitlnlkktnvhdpverdaltklnpqhtiptlvdnghv
    vwesyaivlylvetyakddtlypkdpkvrsvvnqrlffdigtlykriidvihlvmkkeqp
    sdeqmeklkgaldlleqfvterayaaadhltvadicllgtvtalnwlkhdlepfphiraw
    lervraempdyeefskqvaddtlayvasr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v2aC (C:)
    mdyyyslisppcqsaillakklgitlnlkktnvhdpverdaltklnpqhtiptlvdnghv
    vwesyaivlylvetyakddtlypkdpkvrsvvnqrlffdigtlykriidvihlvmkkeqp
    sdeqmeklkgaldlleqfvterayaaadhltvadicllgtvtalnwlkhdlepfphiraw
    lervraempdyeefskqvaddtlayvasrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2aC (C:)
    mdyyyslisppcqsaillakklgitlnlkktnvhdpverdaltklnpqhtiptlvdnghv
    vwesyaivlylvetyakddtlypkdpkvrsvvnqrlffdigtlykriidvihlvmkkeqp
    sdeqmeklkgaldlleqfvterayaaadhltvadicllgtvtalnwlkhdlepfphiraw
    lervraempdyeefskqvaddtlayvas
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v2aD (D:)
    mdyyyslisppcqsaillakklgitlnlkktnvhdpverdaltklnpqhtiptlvdnghv
    vwesyaivlylvetyakddtlypkdpkvrsvvnqrlffdigtlykriidvihlvmkkeqp
    sdeqmeklkgaldlleqfvterayaaadhltvadicllgtvtalnwlkhdlepfphiraw
    lervraempdyeefskqvaddtlayvasrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2aD (D:)
    mdyyyslisppcqsaillakklgitlnlkktnvhdpverdaltklnpqhtiptlvdnghv
    vwesyaivlylvetyakddtlypkdpkvrsvvnqrlffdigtlykriidvihlvmkkeqp
    sdeqmeklkgaldlleqfvterayaaadhltvadicllgtvtalnwlkhdlepfphiraw
    lervraempdyeefskqvaddtlayvas