PDB entry 1v1p

View 1v1p on RCSB PDB site
Description: the structure ssl from staphylococcus aureus from an orthorhombic crystal form
Class: virulence factor
Keywords: virulence factor, antigen presenting cell, secreted protein, staphylococcal exotoxin 1, set1, superantigen, ob-fold, {beta}-grasp
Deposited on 2004-04-21, released 2004-07-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23526
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exotoxin 1
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1P
    • Uniprot Q9ZFS5 (20-End)
    Domains in SCOPe 2.01: d1v1pa1, d1v1pa2
  • Chain 'B':
    Compound: exotoxin 1
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Domains in SCOPe 2.01: d1v1pb1, d1v1pb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v1pA (A:)
    mrgshhhhhhgsaekqervqhlhdirdlhryyssesfeysnvsgkvenyngsnvvrfnpq
    nhqlfllgkdkeqykeglqgqnvfvvqelidpngrlstvggvtkknnktsetntplfvnk
    vngedldasidsfliqkeeislkeldfkirqqlvnnyglykgtskygkiiinlkdenkve
    idlgdklqfermgdvlnskdirgisvtinqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1pA (A:)
    hlhdirdlhryyssesfeysnvsgkvenyngsnvvrfnpqnhqlfllgkdkeqykeglqg
    qnvfvvqelidpngrlstvggvtkknnktsetntplfvnkvngedldasidsfliqkeei
    slkeldfkirqqlvnnyglykgtskygkiiinlkdenkveidlgdklqfermgdvlnskd
    irgisvtinqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v1pB (B:)
    mrgshhhhhhgsaekqervqhlhdirdlhryyssesfeysnvsgkvenyngsnvvrfnpk
    dqnhqlfllgkdkeqykeglqgqnvfvvqelidpngrlstvggvtkknnktsetntplfv
    nkvngedldasidsfliqkeeislkeldfkirqqlvnnyglykgtskygkiiinlkdenk
    veidlgdklqfermgdvlnskdirgisvtinqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1pB (B:)
    hdirdlhryyssesfeysnvsgkvenyngsnvvrfnpkdqnhqlfllgkdkeqykeglqg
    qnvfvvqelidpngrlstvggvtkknnktsetntplfvnkvngedldasidsfliqkeei
    slkeldfkirqqlvnnyglykgtskygkiiinlkdenkveidlgdklqfermgdvlnskd
    irgisvtinqi