PDB entry 1v1i

View 1v1i on RCSB PDB site
Description: Adenovirus fibre shaft sequence N-terminally fused to the bacteriophage T4 fibritin foldon trimerisation motif with a long linker
Class: adenovirus
Keywords: adenovirus, chimera, fiber protein
Deposited on 2004-04-16, released 2004-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibritin, fiber protein
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03275 (0-End)
      • conflict (103)
    • Uniprot P10104 (82-108)
    Domains in SCOPe 2.07: d1v1ia1, d1v1ia2
  • Chain 'B':
    Compound: fibritin, fiber protein
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03275 (0-End)
      • conflict (103)
    • Uniprot P10104 (Start-108)
    Domains in SCOPe 2.07: d1v1ib1, d1v1ib2
  • Chain 'C':
    Compound: fibritin, fiber protein
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03275 (0-End)
      • conflict (103)
    • Uniprot P10104 (Start-108)
    Domains in SCOPe 2.07: d1v1ic1, d1v1ic2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v1iA (A:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitignknddkgsgyipeaprdgqayvrkdgewvllstfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1iA (A:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitigngyipeaprdgqayvrkdgewvllstfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v1iB (B:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitignknddkgsgyipeaprdgqayvrkdgewvllstfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1iB (B:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitigyipeaprdgqayvrkdgewvllstfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v1iC (C:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitignknddkgsgyipeaprdgqayvrkdgewvllstfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1iC (C:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitiipeaprdgqayvrkdgewvllstfl