PDB entry 1v1f

View 1v1f on RCSB PDB site
Description: structure of the arabidopsis thaliana sos3 complexed with calcium(II) and manganese(II) ions
Class: signalling protein
Keywords: signalling protein, salt stress response in plants, calcineurin b-like protein, protein crystallography, calcium sensor, ef-hand
Deposited on 2004-04-15, released 2005-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.238
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcineurin B-like protein 4
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1v1fa_
  • Heterogens: IOD, CA, MN, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v1fA (A:)
    mgcsvskkkkknamrppgyedpellasvtpftveevealyelfkklsssiiddglihkee
    fqlalfrnrnrrnlfadrifdvfdvkrngviefgefvrslgvfhpsapvhekvkfafkly
    dlrqtgfiereelkemvvallheselvlsedmievmvdkafvqadrkndgkididewkdf
    vslnpsliknmtlpylkdinrtfpsfvssceeeemelqnvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1fA (A:)
    rppgyedpellasvtpftveevealyelfkklsssiiddglihkeefqlalfrnrnrrnl
    fadrifdvfdvkrngviefgefvrslgvfhpsapvhekvkfafklydlrqtgfiereelk
    emvvallheselvlsedmievmvdkafvqadrkndgkididewkdfvslnpsliknmtlp
    ylkdinrt