PDB entry 1v10

View 1v10 on RCSB PDB site
Description: structure of rigidoporus lignosus laccase from hemihedrally twinned crystals
Class: oxidase
Keywords: multicopper blue oxidase, oxidase
Deposited on 2004-04-02, released 2004-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.226
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: laccase
    Species: RIGIDOPORUS LIGNOSUS [TaxId:219653]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V10
    Domains in SCOPe 2.07: d1v10a1, d1v10a2, d1v10a3
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v10A (A:)
    mpsfaslkslvvlsltslslaatvaldlhilnanldpdgtgarsavtaegttiaplitgn
    iddrfqinvidqltdanmrratsihwhgffqagttemdgpafvnqcpiipnesfvydfvv
    pgqagtywyhshlstqycdglrgafvvydpndphlslydvddastvitiadwyhslstvl
    fpnpnkappapdttlinglgrnsanpsagqlavvsvqsgkryrfrivstscfpnyafsid
    ghrmtvievdgvshqpltvdsltifagqrysvvveanqavgnywiranpsngrngftggi
    nsaifryqgaavaepttsqnsgtalneanliplinpgapgnpvpggadinlnlrigrnat
    tadftingapfipptvpvllqilsgvtnpndllpggavislpanqvieisipgggnhpfh
    lhghnfdvvrtpgssvynyvnpvrrdvvsiggggdnvtfrfvtdnpgpwflhchidwhle
    aglavvfaedipnipianaispawddlcpkynannpdsgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v10A (A:)
    atvaldlhilnanldpdgtgarsavtaegttiaplitgniddrfqinvidqltdanmrra
    tsihwhgffqagttemdgpafvnqcpiipnesfvydfvvpgqagtywyhshlstqycdgl
    rgafvvydpndphlslydvddastvitiadwyhslstkappapdttlinglgrnsanpsa
    gqlavvsvqsgkryrfrivstscfpnyafsidghrmtvievdgvshqpltvdsltifagq
    rysvvveanqavgnywiranpsngrngftgginsaifryqgaavaepttsqnsgtalnea
    nliplinpgapgnpvpggadinlnlrigrnattadftingapfipptvpvllqilsgvtn
    pndllpggavislpanqvieisipgggnhpfhlhghnfdvvrtpgssvynyvnpvrrdvv
    siggggdnvtfrfvtdnpgpwflhchidwhleaglavvfaedipnipianaispawddlc
    pkynann