PDB entry 1v05

View 1v05 on RCSB PDB site
Description: dimerization of human filamin c: crystal structure of the domain 24
Class: actin-binding protein
Keywords: actin-binding protein, immunoglobulin
Deposited on 2004-03-22, released 2004-11-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.18771
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: filamin c
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 1V05 (0-2)
  • Uniprot Q14315 (3-95)
  Domains in SCOPe 2.05: d1v05a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v05A (A:)
  amgsdaskvvtrgpglsqafvgqknsftvdcskagtnmmmvgvhgpktpceevyvkhmgn
  rvynvtytvkekgdyilivkwgdesvpgspfkvkvp