PDB entry 1uzq

View 1uzq on RCSB PDB site
Description: integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, apo form cbegf23 domain only.
Deposited on 2004-03-15, released 2004-04-08
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-08, with a file datestamp of 2004-04-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.254
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzqA (A:)
    tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldirprgdng
    dtacsneigvgvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitvile
    didecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzqA (A:)
    tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldicsneigv
    gvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitviledidecqelpg
    lcqggkcintfgsfqcrcptgyylnedtrvcd