PDB entry 1uzp

View 1uzp on RCSB PDB site
Description: integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, sm bound form cbegf23 domain only.
Class: matrix protein
Keywords: matrix protein, extra-cellular matrix, fibrillin-1, cbegf domain, tb domain
Deposited on 2004-03-15, released 2004-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.21
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrillin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzpa1, d1uzpa2, d1uzpa3
  • Heterogens: SM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1uzpA (A:)
tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldirprgdng
dtacsneigvgvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitvile
didecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd

    Sequence, based on observed residues (ATOM records): (download) 
    >1uzpA (A:)
tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldicsneigv
gvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitviledidecqelpg
lcqggkcintfgsfqcrcptgyylnedtrvcd