PDB entry 1uzp

View 1uzp on RCSB PDB site
Description: integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, sm bound form cbegf23 domain only.
Class: matrix protein
Keywords: extra-cellular matrix, fibrillin-1, cbegf domain, tb domain, matrix protein
Deposited on 2004-03-15, released 2004-04-08
The last revision prior to the SCOP 1.73 freeze date was dated 2004-04-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.21
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrillin-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uzpa1, d1uzpa2, d1uzpa3
  • Heterogens: SM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1uzpA (A:)
tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldirprgdng
dtacsneigvgvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitvile
didecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd

    Sequence, based on observed residues (ATOM records): (download) 
    >1uzpA (A:)
tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldicsneigv
gvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitviledidecqelpg
lcqggkcintfgsfqcrcptgyylnedtrvcd