PDB entry 1uzp

View 1uzp on RCSB PDB site
Description: Integrin binding cbEGF22-TB4-cbEGF33 fragment of human fibrillin-1, Sm bound form cbEGF23 domain only.
Class: matrix protein
Keywords: matrix protein, extra-cellular matrix, fibrillin-1, cbegf domain, tb domain
Deposited on 2004-03-15, released 2004-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrillin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uzpa1, d1uzpa2, d1uzpa3
  • Heterogens: SM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzpA (A:)
    tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldirprgdng
    dtacsneigvgvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitvile
    didecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzpA (A:)
    tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldicsneigv
    gvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitviledidecqelpg
    lcqggkcintfgsfqcrcptgyylnedtrvcd