PDB entry 1uzk

View 1uzk on RCSB PDB site
Description: integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, ca bound to cbegf23 domain only
Class: glycoprotein
Keywords: extra-cellular matrix, calcium, tb domain, fibrillin-1, glycoprotein, disease mutation, extracellular matrix, polymorphism, cbegf domain, egf-like domain
Deposited on 2004-03-13, released 2006-05-24
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.202
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrillin-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uzka1, d1uzka2, d1uzka3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzkA (A:)
    tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldirprgdng
    dtacsneigvgvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitvile
    didecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzkA (A:)
    tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldicsneigv
    gvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitviledidecqelpg
    lcqggkcintfgsfqcrcptgyylnedtrvcd