PDB entry 1uzh

View 1uzh on RCSB PDB site
Description: a chimeric chlamydomonas, synechococcus rubisco enzyme
Class: lyase
Keywords: lyase, rubisco, photosynthesis, carbon dioxide fixation, photorespiration, oxidoreductase, monooxygenase, chloroplast, transit peptide, multigene family
Deposited on 2004-03-12, released 2005-05-31
The last revision prior to the SCOP 1.75 freeze date was dated 2005-07-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.162
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOP 1.75: d1uzha1, d1uzha2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOP 1.75: d1uzhb1, d1uzhb2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase small chain 2, ribulose bisphosphate carboxylase small chain
    Species: CHLAMYDOMONAS REINHARDTII, SYNECHOCOCCUS SP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1uzhc1
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOP 1.75: d1uzhe1, d1uzhe2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase small chain 2, ribulose bisphosphate carboxylase small chain
    Species: CHLAMYDOMONAS REINHARDTII, SYNECHOCOCCUS SP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1uzhf1
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOP 1.75: d1uzhh1, d1uzhh2
  • Chain 'I':
    Compound: ribulose bisphosphate carboxylase small chain 2, ribulose bisphosphate carboxylase small chain
    Species: CHLAMYDOMONAS REINHARDTII, SYNECHOCOCCUS SP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1uzhi1
  • Chain 'J':
    Compound: ribulose bisphosphate carboxylase small chain 2, ribulose bisphosphate carboxylase small chain
    Species: CHLAMYDOMONAS REINHARDTII, SYNECHOCOCCUS SP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1uzhj1
  • Chain 'K':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOP 1.75: d1uzhk1, d1uzhk2
  • Chain 'M':
    Compound: ribulose bisphosphate carboxylase small chain 2, ribulose bisphosphate carboxylase small chain
    Species: CHLAMYDOMONAS REINHARDTII, SYNECHOCOCCUS SP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1uzhm1
  • Chain 'O':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOP 1.75: d1uzho1, d1uzho2
  • Chain 'P':
    Compound: ribulose bisphosphate carboxylase small chain 2, ribulose bisphosphate carboxylase small chain
    Species: CHLAMYDOMONAS REINHARDTII, SYNECHOCOCCUS SP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1uzhp1
  • Chain 'R':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOP 1.75: d1uzhr1, d1uzhr2
  • Chain 'T':
    Compound: ribulose bisphosphate carboxylase small chain 2, ribulose bisphosphate carboxylase small chain
    Species: CHLAMYDOMONAS REINHARDTII, SYNECHOCOCCUS SP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1uzht1
  • Chain 'V':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOP 1.75: d1uzhv1, d1uzhv2
  • Chain 'W':
    Compound: ribulose bisphosphate carboxylase small chain 2, ribulose bisphosphate carboxylase small chain
    Species: CHLAMYDOMONAS REINHARDTII, SYNECHOCOCCUS SP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1uzhw1
  • Heterogens: MG, CAP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzhA (A:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzhA (A:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uzhB (B:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzhB (B:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzhC (C:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
    pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
    sv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uzhE (E:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzhE (E:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzhF (F:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
    pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
    sv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1uzhH (H:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzhH (H:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzhI (I:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
    pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
    sv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzhJ (J:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
    pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
    sv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1uzhK (K:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzhK (K:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzhM (M:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
    pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
    sv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1uzhO (O:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzhO (O:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzhP (P:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
    pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
    sv
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1uzhR (R:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzhR (R:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzhT (T:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
    pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
    sv
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1uzhV (V:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzhV (V:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzhW (W:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
    pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
    sv