PDB entry 1uyw

View 1uyw on RCSB PDB site
Description: crystal structure of the antiflavivirus fab4g2
Class: immune system
Keywords: immune system
Deposited on 2004-03-03, released 2005-03-10
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab antibody heavy chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1uywh1
  • Chain 'L':
    Compound: fab antibody light chain
    Species: MUS MUSCULUS
  • Chain 'M':
    Compound: fab antibody heavy chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1uywm1
  • Chain 'N':
    Compound: fab antibody light chain
    Species: MUS MUSCULUS
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uywH (H:)
    vqlqqsgpelvkpgtsvkiscktsgytfteytihwvkeaggkslawiggidpnsggtnys
    pnfkgkatltvdkssstaymdlrslssedsavyfcariyhydgyfdvwgagtavtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uywM (M:)
    vqlqqsgpelvkpgtsvkiscktsgytfteytihwvkeaggkslawiggidpnsggtnys
    pnfkgkatltvdkssstaymdlrslssedsavyfcariyhydgyfdvwgagtavtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'N':
    No sequence available.