PDB entry 1uyw

View 1uyw on RCSB PDB site
Description: crystal structure of the antiflavivirus fab4g2
Class: immune system
Keywords: immune system
Deposited on 2004-03-03, released 2005-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.20087
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UYW (0-217)
    Domains in SCOPe 2.07: d1uywh1
  • Chain 'L':
    Compound: fab antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UYW (0-211)
    Domains in SCOPe 2.07: d1uywl1, d1uywl2
  • Chain 'M':
    Compound: fab antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UYW (0-217)
    Domains in SCOPe 2.07: d1uywm1
  • Chain 'N':
    Compound: fab antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UYW (0-End)
    Domains in SCOPe 2.07: d1uywn1, d1uywn2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uywH (H:)
    vqlqqsgpelvkpgtsvkiscktsgytfteytihwvkeaggkslawiggidpnsggtnys
    pnfkgkatltvdkssstaymdlrslssedsavyfcariyhydgyfdvwgagtavtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uywL (L:)
    nivmtqspksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpd
    rftgsgsatdftltissvqaedladyhcgqgysypytfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uywM (M:)
    vqlqqsgpelvkpgtsvkiscktsgytfteytihwvkeaggkslawiggidpnsggtnys
    pnfkgkatltvdkssstaymdlrslssedsavyfcariyhydgyfdvwgagtavtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1uywN (N:)
    nivmtqspksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpd
    rftgsgsatdftltissvqaedladyhcgqgysypytfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uywN (N:)
    nivmtqspksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpd
    rftgsgsatdftltissvqaedladyhcgqgysypytfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr