PDB entry 1uyl

View 1uyl on RCSB PDB site
Description: structure-activity relationships in purine-based inhibitor binding to hsp90 isoforms
Class: chaperone
Keywords: hsp90, ATPase, chaperone, ATP-binding, heat shock
Deposited on 2004-03-02, released 2004-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.2
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UYL
      • conflict (62)
    • Uniprot P07900
    Domains in SCOPe 2.07: d1uyla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uylA (A:)
    mpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkir
    yesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafme
    alqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepm
    grgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uylA (A:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfvek