PDB entry 1ux7

View 1ux7 on RCSB PDB site
Description: carbohydrate-binding module cbm36 in complex with calcium and xylotriose
Class: carbohydrate-binding module
Keywords: carbohydrate binding domain, hydrolase, xylan, calcium, xylanase gh43, carbohydrate-binding module cbm36
Deposited on 2004-02-19, released 2004-10-27
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.1572
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase d
    Species: PAENIBACILLUS POLYMYXA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ux7a_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ux7A (A:)
itkveaenmkiggtyagkisapfdgvalyanadyvsysqyfansthnisvrgassnagta
kvdlviggvtvgsfnftgktptvqtlsnithatgdqeiklaltsddgtwdayvdfiefsl