PDB entry 1uwx

View 1uwx on RCSB PDB site
Description: p1.2 serosubtype antigen derived from n. meningitidis pora in complex with fab fragment
Class: immune system
Keywords: immune system, antibody-complex, fab, immunoglobulin, protein g, pora, antibody, igb
Deposited on 2004-02-12, released 2005-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.225
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein g-prime
    Species: Streptococcus sp. [TaxId:1306]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54181
      • engineered mutation (22)
    Domains in SCOPe 2.07: d1uwxa_
  • Chain 'B':
    Compound: protein g-prime
    Species: Streptococcus sp. [TaxId:1306]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54181 (Start-62)
      • engineered mutation (22)
    Domains in SCOPe 2.07: d1uwxb_
  • Chain 'H':
    Compound: antibody
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWX (Start-224)
    Domains in SCOPe 2.07: d1uwxh1
  • Chain 'K':
    Compound: antibody
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWX (0-End)
  • Chain 'L':
    Compound: antibody
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWX (0-End)
  • Chain 'M':
    Compound: antibody
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWX (Start-224)
    Domains in SCOPe 2.07: d1uwxm1
  • Chain 'P':
    Compound: class 1 outer membrane protein variable region 2
    Species: NEISSERIA MENINGITIDIS, synthetic [TaxId:487]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: class 1 outer membrane protein variable region 2
    Species: NEISSERIA MENINGITIDIS, synthetic [TaxId:487]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uwxA (A:)
    tpavttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvte
    kpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwxA (A:)
    vttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvtek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uwxB (B:)
    tpavttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvte
    kpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwxB (B:)
    vttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvtekpe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1uwxH (H:)
    dvqlqqsgpelkkpgetvklsckasgytftnfglnwmkqapgkglkwmgwintytgesty
    addfkgrfafsletsastaylqinnvknedtatyfcargfyyygsryfyfdywgqgttlt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwxH (H:)
    vqlqqsgpelkkpgetvklsckasgytftnfglnwmkqapgkglkwmgwintytgestya
    ddfkgrfafsletsastaylqinnvknedtatyfcargfyyygsryfyfdywgqgttltv
    ssakttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkieprgp
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1uwxM (M:)
    dvqlqqsgpelkkpgetvklsckasgytftnfglnwmkqapgkglkwmgwintytgesty
    addfkgrfafsletsastaylqinnvknedtatyfcargfyyygsryfyfdywgqgttlt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwxM (M:)
    vqlqqsgpelkkpgetvklsckasgytftnfglnwmkqapgkglkwmgwintytgestya
    ddfkgrfafsletsastaylqinnvknedtatyfcargfyyygsryfyfdywgqgttltv
    ssakttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkieprgp
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.