PDB entry 1uwn

View 1uwn on RCSB PDB site
Description: The Initial Events in the Photocycle of Photoactive Yellow Protein: A Common Mechanism on Light Activation in Photoreceptor Proteins
Class: signaling protein
Keywords: signaling protein, pas, lov, photocycle, photoreceptor
Deposited on 2004-02-10, released 2004-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Photoactive yellow protein
  Species: Halorhodospira halophila [TaxId:1053]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
  Domains in SCOPe 2.08: d1uwnx_
• Heterogens: HC4, SO4, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uwnX (X:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv