PDB entry 1uwm

View 1uwm on RCSB PDB site
Description: reduced ferredoxin 6 from Rhodobacter capsulatus
Class: electron transport
Keywords: ferredoxin, electron transport, metal-binding, iron-sulfur, iron, 2fe-2s
Deposited on 2004-02-05, released 2006-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin vi
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uwma_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwmA (A:)
    akiifiehngtrheveakpgltvmeaardngvpgidadcggacacstchayvdpawvdkl
    pkalptetdmidfayepnpatsrltcqikvtslldglvvhlpekqi