PDB entry 1uwj

View 1uwj on RCSB PDB site
Description: The complex of mutant V599E B-RAF and BAY439006
Class: transferase
Keywords: transferase, threonine-protein kinase, signal transduction
Deposited on 2004-02-05, released 2004-03-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.275
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15056 (0-275)
      • engineered mutation (152)
    Domains in SCOPe 2.03: d1uwja_
  • Chain 'B':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15056 (0-275)
      • engineered mutation (152)
    Domains in SCOPe 2.03: d1uwjb_
  • Heterogens: BAX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uwjA (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglateksrwsgshqfeqlsgsilwmapevirm
    qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
    amkrlmaeclkkkrderplfpqilasiellarslpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwjA (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglateksgsilwmapevirmqdknpysfqsdv
    yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
    krderplfpqilasiellarslpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uwjB (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglateksrwsgshqfeqlsgsilwmapevirm
    qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
    amkrlmaeclkkkrderplfpqilasiellarslpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwjB (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatekgsilwmapevirmqdknpysfqsdvy
    afgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkk
    rderplfpqilasiellarslpk