PDB entry 1uwh

View 1uwh on RCSB PDB site
Description: The complex of wild type B-RAF and BAY439006
Class: transferase
Keywords: transferase
Deposited on 2004-02-05, released 2004-03-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.222
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1uwha_
  • Chain 'B':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1uwhb_
  • Heterogens: BAX, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uwhA (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm
    qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
    amkrlmaeclkkkrderplfpqilasiellarslpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwhA (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvlsgsilwmapevirmqdknpysfqsdv
    yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
    krderplfpqilasiellarslpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uwhB (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm
    qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
    amkrlmaeclkkkrderplfpqilasiellarslpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwhB (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvlsgsilwmapevirmqdknpysfqsdv
    yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
    krderplfpqilasiellarslpk