PDB entry 1uwg

View 1uwg on RCSB PDB site
Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9
Class: antibody
Keywords: antibody, catalytic antibody
Deposited on 2004-02-05, released 2004-02-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.207
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody 14d9
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWG
    Domains in SCOPe 2.04: d1uwgh1, d1uwgh2
  • Chain 'L':
    Compound: antibody 14d9
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWG (0-212)
    Domains in SCOPe 2.04: d1uwgl1, d1uwgl2
  • Chain 'X':
    Compound: antibody 14d9
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWG (0-212)
    Domains in SCOPe 2.04: d1uwgx1, d1uwgx2
  • Chain 'Y':
    Compound: antibody 14d9
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWG
    Domains in SCOPe 2.04: d1uwgy1, d1uwgy2
  • Heterogens: KHA, PO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1uwgH (H:)
    qvqllesgpelvepgasvkvsckasaysitdfniywvkqshgknlewiggidphnggpvy
    nqkfngkatltvdkssstafmhlnsltsedsavyycaifygnffdywgpgttvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwgH (H:)
    qllesgpelvepgasvkvsckasaysitdfniywvkqshgknlewiggidphnggpvynq
    kfngkatltvdkssstafmhlnsltsedsavyycaifygnffdywgpgttvtvssastkg
    psvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvps
    sslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwgL (L:)
    elvmtqspkfmstsvgdrvsvtckasqnvgthvawyqqkpgqspktliysasyrysgvpd
    rftgsgsgtdftltirdvqsedaaeyfcqqynlfpvtfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreaavawkvdnalqsgnsqesvteqdsadstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwgX (X:)
    elvmtqspkfmstsvgdrvsvtckasqnvgthvawyqqkpgqspktliysasyrysgvpd
    rftgsgsgtdftltirdvqsedaaeyfcqqynlfpvtfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreaavawkvdnalqsgnsqesvteqdsadstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1uwgY (Y:)
    qvqllesgpelvepgasvkvsckasaysitdfniywvkqshgknlewiggidphnggpvy
    nqkfngkatltvdkssstafmhlnsltsedsavyycaifygnffdywgpgttvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwgY (Y:)
    qllesgpelvepgasvkvsckasaysitdfniywvkqshgknlewiggidphnggpvynq
    kfngkatltvdkssstafmhlnsltsedsavyycaifygnffdywgpgttvtvssastkg
    psvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvps
    sslgtqtyicnvnhkpsntkvdkkvepks