PDB entry 1uwe

View 1uwe on RCSB PDB site
Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9
Class: antibody
Keywords: antibody
Deposited on 2004-02-05, released 2004-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody 14d9
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWE (0-217)
    Domains in SCOPe 2.06: d1uweh1, d1uweh2
  • Chain 'L':
    Compound: antibody 14d9
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWE (0-212)
    Domains in SCOPe 2.06: d1uwel1, d1uwel2
  • Chain 'U':
    Compound: antibody 14d9
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWE (0-212)
    Domains in SCOPe 2.06: d1uweu1, d1uweu2
  • Chain 'V':
    Compound: antibody 14d9
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWE (0-217)
    Domains in SCOPe 2.06: d1uwev1, d1uwev2
  • Chain 'X':
    Compound: antibody 14d9
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWE (0-212)
    Domains in SCOPe 2.06: d1uwex1, d1uwex2
  • Chain 'Y':
    Compound: antibody 14d9
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UWE (0-217)
    Domains in SCOPe 2.06: d1uwey1, d1uwey2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uweH (H:)
    llaqsgpelvkpgasvkiscaasaysitdftiywvkqshgdslewiggidphngggaynq
    kfrvkatltvdtssstayihlnsltsedsavyycaifygnffdywgqgttvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntavdkavepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uweL (L:)
    ldnvmtqspsfmstsvgdrvsvtcaasqnvgtnvawyqqkpgqppkaliystsyrysgvp
    drftgsgsgtdftltisnvnsedlaeyfcqqyniypvtfgggtkleikrtvaapsvfifp
    psaeqlasgtasvvcllnnfypreaavqwkvdnalqsgnsqesvteqdsadstyslsstl
    tlskadyeahavyacevthqglsspvtksfnrg
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uweU (U:)
    ldnvmtqspsfmstsvgdrvsvtcaasqnvgtnvawyqqkpgqppkaliystsyrysgvp
    drftgsgsgtdftltisnvnsedlaeyfcqqyniypvtfgggtkleikrtvaapsvfifp
    psaeqlasgtasvvcllnnfypreaavqwkvdnalqsgnsqesvteqdsadstyslsstl
    tlskadyeahavyacevthqglsspvtksfnrg
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uweV (V:)
    llaqsgpelvkpgasvkiscaasaysitdftiywvkqshgdslewiggidphngggaynq
    kfrvkatltvdtssstayihlnsltsedsavyycaifygnffdywgqgttvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntavdkavepksc
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uweX (X:)
    ldnvmtqspsfmstsvgdrvsvtcaasqnvgtnvawyqqkpgqppkaliystsyrysgvp
    drftgsgsgtdftltisnvnsedlaeyfcqqyniypvtfgggtkleikrtvaapsvfifp
    psaeqlasgtasvvcllnnfypreaavqwkvdnalqsgnsqesvteqdsadstyslsstl
    tlskadyeahavyacevthqglsspvtksfnrg
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uweY (Y:)
    llaqsgpelvkpgasvkiscaasaysitdftiywvkqshgdslewiggidphngggaynq
    kfrvkatltvdtssstayihlnsltsedsavyycaifygnffdywgqgttvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntavdkavepksc