PDB entry 1uvx

View 1uvx on RCSB PDB site
Description: heme-ligand tunneling on group i truncated hemoglobins
Deposited on 2004-01-27, released 2004-03-18
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-18, with a file datestamp of 2004-03-18.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.216
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1uvxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uvxA (A:)
slfaklggreaveaavdkfynkivadptvstyfsntdmkvqrskqfaflayalggasewk
gkdmrtahkdlvphlsdvhfqavarhlsdtltelgvppeditdamavvastrtevlnmpq
q