PDB entry 1uvq

View 1uvq on RCSB PDB site
Description: crystal structure of hla-dq0602 in complex with a hypocretin peptide
Class: immunology
Keywords: immunology, MHC class II, diabetes, narcolepsy, autoimmune disease, structural proteomics in europe, spine, structural genomics
Deposited on 2004-01-22, released 2004-02-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hla class II histocompatibility antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01907
    • PDB 1UVQ (12-27)
    Domains in SCOPe 2.02: d1uvqa1, d1uvqa2
  • Chain 'B':
    Compound: hla class II histocompatibility antigen
    Domains in SCOPe 2.02: d1uvqb1, d1uvqb2
  • Chain 'C':
    Compound: orexin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GLY, NAG, ZN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uvqA (A:)
    edivadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpq
    galrnmavakhnlnimikrynstaatnevpevtvfskspvtlgqpntliclvdnifppvv
    nitwlsngqsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldqpllkh
    wepeipapmseltetvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uvqA (A:)
    divadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqg
    alrnmavakhnlnimikrynstaatnevpevtvfskspvtlgqpntliclvdnifppvvn
    itwlsngqsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldqpllkhw
    ep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uvqB (B:)
    spedfvfqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtpqgrpdaeywn
    sqkevlegtraeldtvcrhnyevafrgilqrrveptvtispsrtealnhhnllvcsvtdf
    ypgqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqs
    pitvewraqsesaqskvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uvqB (B:)
    spedfvfqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtpqgrpdaeywn
    sqkevlegtraeldtvcrhnyevafrgilqrrveptvtispsnllvcsvtdfypgqikvr
    wfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewra
    q
    

  • Chain 'C':
    No sequence available.