PDB entry 1uvh

View 1uvh on RCSB PDB site
Description: x-ray structure of dps from mycobacterium smegmatis
Class: DNA binding protein
Keywords: DNA protection from oxidative damage, DNA binding protein
Deposited on 2004-01-20, released 2005-02-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.27
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1uvha_
  • Chain 'B':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1uvhb_
  • Chain 'C':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1uvhc_
  • Chain 'D':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1uvhd_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uvhA (A:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uvhA (A:)
    tipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgy
    adevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksi
    ekledldlvsqdlliahagelekfqwfvrahlesagg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uvhB (B:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uvhB (B:)
    tipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgy
    adevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksi
    ekledldlvsqdlliahagelekfqwfvrahlesagg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uvhC (C:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uvhC (C:)
    tipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgy
    adevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksi
    ekledldlvsqdlliahagelekfqwfvrahlesagg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uvhD (D:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uvhD (D:)
    tipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgy
    adevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksi
    ekledldlvsqdlliahagelekfqwfvrahlesagg