PDB entry 1uuw

View 1uuw on RCSB PDB site
Description: naphthalene 1,2-dioxygenase with nitric oxide bound in the active site.
Class: oxidoreductase
Keywords: oxidoreductase, non-heme iron dioxygenase, enzyme-substrate complex, aromatic hydrocarbons catabolism, metal-binding, iron-sulfur, iron, 2fe-2s, dioxygenase, nad, plasmid
Deposited on 2004-01-11, released 2005-02-09
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Naphthalene 1,2-dioxygenase alpha subunit
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uuwa1, d1uuwa2
  • Chain 'B':
    Compound: Naphthalene 1,2-dioxygenase beta subunit
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uuwb1
  • Heterogens: FE, SO4, FES, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uuwA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkttdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uuwA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltktt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uuwB (B:)
    mminiqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgs
    evqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfi
    tnvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdy
    perilqthnlmvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uuwB (B:)
    miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
    vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
    nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
    erilqthnlmvfl