PDB entry 1uub

View 1uub on RCSB PDB site
Description: solution structure of a truncated bovine pancreatic trypsin inhibitor mutant, 3-58 bpti (k15r, r17a, r42s)
Class: inhibitor
Keywords: serine protease inhibitor, signal, pharmaceutical, 3d-struct
Deposited on 2003-12-17, released 2004-01-29
The last revision prior to the SCOP 1.75 freeze date was dated 2004-01-29, with a file datestamp of 2007-07-20.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-55)
      • engineered mutation (12)
      • engineered mutation (14)
      • engineered mutation (39)
    Domains in SCOP 1.75: d1uuba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uubA (A:)
    dfcleppytgpcraaiiryfynakaglcqtfvyggcraksnnfksaedcmrtcgga