PDB entry 1utz

View 1utz on RCSB PDB site
Description: crystal structure of mmp-12 complexed to (2r)-3-({[4-[(pyri din-4-yl)phenyl]-thien-2-yl}carboxamido)(phenyl)propanoic acid
Class: hydrolase
Keywords: macrophage metalloelastase, non-zinc chelator, mmp-12, mmp inhibitor, hydrolase, metalloprotease
Deposited on 2003-12-12, released 2004-12-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1utza_
  • Chain 'B':
    Compound: Macrophage metalloelastase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1utzb_
  • Heterogens: ZN, CA, PF3, HAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1utzA (A:)
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1utzB (B:)
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygd